![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.10: Polcalcin [89048] (3 proteins) calcium-binding pollen allergen; two EF-hands per subunit |
![]() | Protein Polcalcin phl p 7 [89049] (1 species) |
![]() | Species Timothy grass (Phleum pratense) [TaxId:15957] [89050] (4 PDB entries) |
![]() | Domain d1k9ua_: 1k9u A: [84348] EF-hand swapped homodimer complexed with ca, so4 |
PDB Entry: 1k9u (more details), 1.75 Å
SCOPe Domain Sequences for d1k9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9ua_ a.39.1.10 (A:) Polcalcin phl p 7 {Timothy grass (Phleum pratense) [TaxId: 15957]} ddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefis fcnanpglmkdvakvf
Timeline for d1k9ua_: