PDB entry 1k9u

View 1k9u on RCSB PDB site
Description: Crystal Structure of the Calcium-Binding Pollen Allergen Phl p 7 (Polcalcin) at 1.75 Angstroem
Class: allergen
Keywords: pollen allergen, calcium-binding, EF-hand, cross-reactivity
Deposited on 2001-10-30, released 2003-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.192
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polcalcin Phl p 7
    Species: Phleum pratense [TaxId:15957]
    Gene: Phlpr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1k9ua_
  • Chain 'B':
    Compound: Polcalcin Phl p 7
    Species: Phleum pratense [TaxId:15957]
    Gene: Phlpr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1k9ub_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9uA (A:)
    maddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnef
    isfcnanpglmkdvakvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9uA (A:)
    ddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefis
    fcnanpglmkdvakvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k9uB (B:)
    maddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnef
    isfcnanpglmkdvakvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9uB (B:)
    ddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefis
    fcnanpglmkdvakvf