| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
| Protein Oligoribonuclease [89719] (2 species) |
| Species Haemophilus influenzae [TaxId:727] [89720] (1 PDB entry) HI1715 |
| Domain d1j9aa1: 1j9a A:4-185 [84135] Other proteins in same PDB: d1j9aa2 CASP4 structural genomics complexed with so4 |
PDB Entry: 1j9a (more details), 2.5 Å
SCOPe Domain Sequences for d1j9aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9aa1 c.55.3.5 (A:4-185) Oligoribonuclease {Haemophilus influenzae [TaxId: 727]}
msfdkqnliwidlemtgldpekeriieiativtdknlnilaegpvlavhqsdellnkmnd
wcqkthsenglierikasklteraaelqtldflkkwvpkgaspicgnsiaqdkrflvkym
pdladyfhyrhldvstlkelaarwkpeilegfkkenthlalddiresikelayyrehfmk
ld
Timeline for d1j9aa1: