Lineage for d1j9aa_ (1j9a A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316908Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 317107Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (6 proteins)
  6. 317182Protein Oligoribonuclease [89719] (1 species)
  7. 317183Species Haemophilus influenzae [TaxId:727] [89720] (1 PDB entry)
    HI1715
  8. 317184Domain d1j9aa_: 1j9a A: [84135]
    CASP4
    structural genomics
    complexed with mse, so4

Details for d1j9aa_

PDB Entry: 1j9a (more details), 2.5 Å

PDB Description: oligoribonuclease

SCOP Domain Sequences for d1j9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9aa_ c.55.3.5 (A:) Oligoribonuclease {Haemophilus influenzae}
shmsfdkqnliwidlemtgldpekeriieiativtdknlnilaegpvlavhqsdellnkm
ndwcqkthsenglierikasklteraaelqtldflkkwvpkgaspicgnsiaqdkrflvk
ympdladyfhyrhldvstlkelaarwkpeilegfkkenthlalddiresikelayyrehf
mkld

SCOP Domain Coordinates for d1j9aa_:

Click to download the PDB-style file with coordinates for d1j9aa_.
(The format of our PDB-style files is described here.)

Timeline for d1j9aa_: