PDB entry 1j9a

View 1j9a on RCSB PDB site
Description: oligoribonuclease
Class: hydrolase
Keywords: RIBONUCLEASE, EXORIBONUCLEASE, OLIGORIBONUCLEASE, HAEMOPHILUS INFLUENZAE, Structure 2 Function Project, S2F, Structural Genomics, HYDROLASE
Deposited on 2001-05-24, released 2003-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligoribonuclease
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45340 (2-183)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (16)
      • modified residue (59)
      • modified residue (121)
      • modified residue (180)
    Domains in SCOPe 2.06: d1j9aa1, d1j9aa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j9aA (A:)
    shmsfdkqnliwidlemtgldpekeriieiativtdknlnilaegpvlavhqsdellnkm
    ndwcqkthsenglierikasklteraaelqtldflkkwvpkgaspicgnsiaqdkrflvk
    ympdladyfhyrhldvstlkelaarwkpeilegfkkenthlalddiresikelayyrehf
    mkld