Lineage for d1j10d1 (1j10 D:418-516)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1526161Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1526162Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 1526163Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 1526164Protein beta-amylase [49462] (1 species)
  7. 1526165Species Bacillus cereus [TaxId:1396] [49463] (12 PDB entries)
  8. 1526181Domain d1j10d1: 1j10 D:418-516 [83938]
    Other proteins in same PDB: d1j10a2, d1j10b2, d1j10c2, d1j10d2
    complexed with ca

Details for d1j10d1

PDB Entry: 1j10 (more details), 2.1 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with ggx
PDB Compounds: (D:) beta-amylase

SCOPe Domain Sequences for d1j10d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j10d1 b.3.1.1 (D:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOPe Domain Coordinates for d1j10d1:

Click to download the PDB-style file with coordinates for d1j10d1.
(The format of our PDB-style files is described here.)

Timeline for d1j10d1: