| Class b: All beta proteins [48724] (126 folds) |
| Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain [49452] (1 family) ![]() |
| Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
| Protein beta-amylase [49462] (1 species) |
| Species Bacillus cereus [TaxId:1396] [49463] (11 PDB entries) |
| Domain d1j10d1: 1j10 D:418-516 [83938] Other proteins in same PDB: d1j10a2, d1j10b2, d1j10c2, d1j10d2 complexed with ca, glc, xys |
PDB Entry: 1j10 (more details), 2.1 Å
SCOP Domain Sequences for d1j10d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j10d1 b.3.1.1 (D:418-516) beta-amylase {Bacillus cereus}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw
Timeline for d1j10d1: