SCOPe 2.01: Domain d1iyhb1: 1iyh B:276-399

Lineage for d1iyhb1 (1iyh B:276-399)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (11 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d1iyhb1: 1iyh B:276-399 [83792]
   Other proteins in same PDB: d1iyha2, d1iyhb2, d1iyhc2, d1iyhd2
   complexed with gsh, mg

Details for d1iyhb1

PDB Entry: 1iyh, 1.7 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

PDB Compounds: (B:) hematopoietic prostagladin d synthase

SCOPe Domain Sequences for d1iyhb1:

Sequence; same for both SEQRES and ATOM records:

>d1iyhb1 a.45.1.1 (B:276-399) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d1iyhb1:

• d1iyhb1 first appeared in SCOP 1.65
  
• d1iyhb1 appears in SCOP 1.75
  
• d1iyhb1 appears in SCOPe 2.02
  
• d1iyhb1 appears in the current release, SCOPe 2.08