Lineage for d1iyha2 (1iyh A:2-75)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992723Protein Class sigma GST [81362] (5 species)
  7. 992736Species Human (Homo sapiens) [TaxId:9606] [89705] (11 PDB entries)
    Uniprot O60760
    synonym: hematopoietic prostaglandin D synthase
  8. 992741Domain d1iyha2: 1iyh A:2-75 [83791]
    Other proteins in same PDB: d1iyha1, d1iyhb1, d1iyhc1, d1iyhd1
    complexed with gsh, mg

Details for d1iyha2

PDB Entry: 1iyh (more details), 1.7 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase
PDB Compounds: (A:) hematopoietic prostagladin d synthase

SCOPe Domain Sequences for d1iyha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyha2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d1iyha2:

Click to download the PDB-style file with coordinates for d1iyha2.
(The format of our PDB-style files is described here.)

Timeline for d1iyha2: