![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins) automatically mapped to Pfam PF13474 automatically mapped to Pfam PF08332 |
![]() | Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [89853] (1 PDB entry) |
![]() | Domain d1hkxi_: 1hkx I: [83575] complexed with cl, dtt, tbr |
PDB Entry: 1hkx (more details), 2.65 Å
SCOPe Domain Sequences for d1hkxi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkxi_ d.17.4.7 (I:) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Mouse (Mus musculus) [TaxId: 10090]} edtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe nlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg kwqivhfhrsgapsv
Timeline for d1hkxi_: