Lineage for d1hkxi_ (1hkx I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896612Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
    automatically mapped to Pfam PF13474
    automatically mapped to Pfam PF08332
  6. 1896613Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species)
  7. 1896616Species Mouse (Mus musculus) [TaxId:10090] [89853] (1 PDB entry)
  8. 1896625Domain d1hkxi_: 1hkx I: [83575]
    complexed with cl, dtt, tbr

Details for d1hkxi_

PDB Entry: 1hkx (more details), 2.65 Å

PDB Description: crystal structure of calcium/calmodulin-dependent protein kinase
PDB Compounds: (I:) calcium/calmodulin-dependent protein kinase type II alpha chain

SCOPe Domain Sequences for d1hkxi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkxi_ d.17.4.7 (I:) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Mouse (Mus musculus) [TaxId: 10090]}
edtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
nlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
kwqivhfhrsgapsv

SCOPe Domain Coordinates for d1hkxi_:

Click to download the PDB-style file with coordinates for d1hkxi_.
(The format of our PDB-style files is described here.)

Timeline for d1hkxi_: