| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
| Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
| Protein Sigma factor SigA [88663] (1 species) |
| Species Thermus aquaticus [TaxId:271] [88664] (1 PDB entry) |
| Domain d1ku2a1: 1ku2 A:273-332 [83096] Other proteins in same PDB: d1ku2a2, d1ku2b2 complexed with so4 |
PDB Entry: 1ku2 (more details), 2.9 Å
SCOPe Domain Sequences for d1ku2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ku2a1 a.4.13.1 (A:273-332) Sigma factor SigA {Thermus aquaticus [TaxId: 271]}
iripvhmvetinklsrtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsl
Timeline for d1ku2a1: