PDB entry 1ku2

View 1ku2 on RCSB PDB site
Description: Crystal Structure of Thermus aquaticus RNA Polymerase Sigma Subunit Fragment Containing Regions 1.2 to 3.1
Class: transcription
Keywords: helices, TRANSCRIPTION
Deposited on 2002-01-21, released 2002-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sigma factor sigA
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ku2a1, d1ku2a2
  • Chain 'B':
    Compound: sigma factor sigA
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ku2b1, d1ku2b2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ku2A (A:)
    tsdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakil
    gtariqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvv
    siakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqar
    tiripvhmvetinklsrtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvs
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ku2A (A:)
    sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
    tariqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvs
    iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart
    iripvhmvetinklsrtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ku2B (B:)
    tsdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakil
    gtariqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvv
    siakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqar
    tiripvhmvetinklsrtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvs
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ku2B (B:)
    sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
    tariqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvs
    iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart
    iripvhmvetinklsrtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsl