SCOPe 2.01: Domain d1k8wa3: 1k8w A:251-312

Lineage for d1k8wa3 (1k8w A:251-312)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)

7. Species Escherichia coli [TaxId:562] [88700] (3 PDB entries)

8. Domain d1k8wa3: 1k8w A:251-312 [83094]
   Other proteins in same PDB: d1k8wa5
   protein/RNA complex; complexed with so4

Details for d1k8wa3

PDB Entry: 1k8w, 1.85 Å

PDB Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA

PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1k8wa3:

Sequence; same for both SEQRES and ATOM records:

>d1k8wa3 b.122.1.1 (A:251-312) Pseudouridine synthase II TruB, C-terminal domain {Escherichia coli [TaxId: 562]}
ypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvv
ey

Timeline for d1k8wa3:

• d1k8wa3 first appeared in SCOP 1.65
  
• d1k8wa3 appears in SCOP 1.75
  
• d1k8wa3 appears in SCOPe 2.02
  
• d1k8wa3 appears in the current release, SCOPe 2.08