Lineage for d1k8wa3 (1k8w A:251-312)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2823866Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. 2823889Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
  7. 2823890Species Escherichia coli [TaxId:562] [88700] (3 PDB entries)
  8. 2823891Domain d1k8wa3: 1k8w A:251-312 [83094]
    Other proteins in same PDB: d1k8wa5, d1k8wa6
    protein/RNA complex; complexed with so4

Details for d1k8wa3

PDB Entry: 1k8w (more details), 1.85 Å

PDB Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA
PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1k8wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8wa3 b.122.1.1 (A:251-312) Pseudouridine synthase II TruB, C-terminal domain {Escherichia coli [TaxId: 562]}
ypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvv
ey

SCOPe Domain Coordinates for d1k8wa3:

Click to download the PDB-style file with coordinates for d1k8wa3.
(The format of our PDB-style files is described here.)

Timeline for d1k8wa3: