![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (3 families) ![]() |
![]() | Family b.122.1.1: PUA domain [88698] (2 proteins) RNA-binding domain |
![]() | Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [88700] (1 PDB entry) |
![]() | Domain d1k8wa3: 1k8w A:251-312 [83094] Other proteins in same PDB: d1k8wa1, d1k8wa4 complexed with fhu, so4; mutant |
PDB Entry: 1k8w (more details), 1.85 Å
SCOP Domain Sequences for d1k8wa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8wa3 b.122.1.1 (A:251-312) Pseudouridine synthase II TruB, C-terminal domain {Escherichia coli} ypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvv ey
Timeline for d1k8wa3: