| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) |
| Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
| Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (30 PDB entries) |
| Domain d1qica_: 1qic A: [81262] |
PDB Entry: 1qic (more details), 2 Å
SCOP Domain Sequences for d1qica_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qica_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
ipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfav
rehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighslg
lfhsantealmyplyhsltdltrfrlsqddingiqslygpp
Timeline for d1qica_: