| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein) lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain |
| Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species) |
| Species Methylophilus methylotrophus [TaxId:17] [82379] (6 PDB entries) |
| Domain d1o97d2: 1o97 D:196-318 [81234] Other proteins in same PDB: d1o97c_, d1o97d1 complexed with amp, fad |
PDB Entry: 1o97 (more details), 1.6 Å
SCOPe Domain Sequences for d1o97d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o97d2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]}
didittvdfimsigrgigeetnveqfreladeagatlccsrpiadagwlpksrqvgqsgk
vvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdieeelk
aql
Timeline for d1o97d2: