SCOPe 2.03: Domain d1o97d1: 1o97 D:1-192

Lineage for d1o97d1 (1o97 D:1-192)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (3 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
   contains an additional FAD-binding domain of DHS-like fold

7. Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries)

8. Domain d1o97d1: 1o97 D:1-192 [81233]
   Other proteins in same PDB: d1o97c_, d1o97d2
   complexed with amp, fad

Details for d1o97d1

PDB Entry: 1o97, 1.6 Å

PDB Description: structure of electron transferring flavoprotein from methylophilus methylotrophus, recognition loop removed by limited proteolysis

PDB Compounds: (D:) electron transferring flavoprotein alpha-subunit

SCOPe Domain Sequences for d1o97d1:

Sequence; same for both SEQRES and ATOM records:

>d1o97d1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyvevg

Timeline for d1o97d1:

• d1o97d1 first appeared in SCOP 1.63
  
• d1o97d1 appears in SCOPe 2.02
  
• d1o97d1 appears in SCOPe 2.04
  
• d1o97d1 appears in the current release, SCOPe 2.08