Lineage for d1o97d2 (1o97 D:196-318)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107266Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
    lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain
  6. 2107267Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)
  7. 2107270Species Methylophilus methylotrophus [TaxId:17] [82379] (6 PDB entries)
  8. 2107272Domain d1o97d2: 1o97 D:196-318 [81234]
    Other proteins in same PDB: d1o97c_, d1o97d1
    complexed with amp, fad

Details for d1o97d2

PDB Entry: 1o97 (more details), 1.6 Å

PDB Description: structure of electron transferring flavoprotein from methylophilus methylotrophus, recognition loop removed by limited proteolysis
PDB Compounds: (D:) electron transferring flavoprotein alpha-subunit

SCOPe Domain Sequences for d1o97d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o97d2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]}
didittvdfimsigrgigeetnveqfreladeagatlccsrpiadagwlpksrqvgqsgk
vvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdieeelk
aql

SCOPe Domain Coordinates for d1o97d2:

Click to download the PDB-style file with coordinates for d1o97d2.
(The format of our PDB-style files is described here.)

Timeline for d1o97d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o97d1
View in 3D
Domains from other chains:
(mouse over for more information)
d1o97c_