SCOP 1.63: Domain d1o97d2: 1o97 D:196-318

Lineage for d1o97d2 (1o97 D:196-318)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
   lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain

6. Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)

7. Species Methylophilus methylotrophus [TaxId:17] [82379] (2 PDB entries)

8. Domain d1o97d2: 1o97 D:196-318 [81234]
   Other proteins in same PDB: d1o97c_, d1o97d1
   complexed with amp, fad

Details for d1o97d2

PDB Entry: 1o97, 1.6 Å

PDB Description: structure of electron transferring flavoprotein from methylophilus methylotrophus, recognition loop removed by limited proteolysis

SCOP Domain Sequences for d1o97d2:

Sequence; same for both SEQRES and ATOM records:

>d1o97d2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus}
didittvdfimsigrgigeetnveqfreladeagatlccsrpiadagwlpksrqvgqsgk
vvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdieeelk
aql

Timeline for d1o97d2:

• d1o97d2 is new in SCOP 1.63
  
• d1o97d2 appears in SCOP 1.65
  
• d1o97d2 appears in the current release, SCOPe 2.08