Lineage for d1nm1a2 (1nm1 A:147-375)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171253Protein Actin [53073] (6 species)
  7. 1171385Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries)
  8. 1171387Domain d1nm1a2: 1nm1 A:147-375 [80652]
    Other proteins in same PDB: d1nm1g_
    complexed with atp, ca, mg, so2, so4

Details for d1nm1a2

PDB Entry: 1nm1 (more details), 1.8 Å

PDB Description: Crystal Structure of D. Dicsoideum Actin Complexed With Gelsolin Segment 1 and Mg ATP at 1.8 A Resolution
PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1nm1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nm1a2 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeqemataasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

SCOPe Domain Coordinates for d1nm1a2:

Click to download the PDB-style file with coordinates for d1nm1a2.
(The format of our PDB-style files is described here.)

Timeline for d1nm1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nm1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1nm1g_