|  | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) | 
|  | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest | 
|  | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)  duplication contains two domains of this fold | 
|  | Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) | 
|  | Protein Actin [53073] (6 species) | 
|  | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries) | 
|  | Domain d1nm1a2: 1nm1 A:147-375 [80652] Other proteins in same PDB: d1nm1g_ complexed with atp, ca, mg, so2, so4 | 
PDB Entry: 1nm1 (more details), 1.8 Å
SCOPe Domain Sequences for d1nm1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nm1a2 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeqemataasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf
Timeline for d1nm1a2: