SCOPe 2.02: Domain d1nm1a1: 1nm1 A:4-146

Lineage for d1nm1a1 (1nm1 A:4-146)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries)

8. Domain d1nm1a1: 1nm1 A:4-146 [80651]
   Other proteins in same PDB: d1nm1g_
   complexed with atp, ca, mg, so2, so4

Details for d1nm1a1

PDB Entry: 1nm1, 1.8 Å

PDB Description: Crystal Structure of D. Dicsoideum Actin Complexed With Gelsolin Segment 1 and Mg ATP at 1.8 A Resolution

PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1nm1a1:

Sequence, based on SEQRES records:

>d1nm1a1 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1nm1a1 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dvqalvidngsgmckagfagddapravfpsivgrprhtkdsyvgdeaqskrgiltlkypi
ehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpa
myvaiqavlslyasg

Timeline for d1nm1a1:

• d1nm1a1 first appeared in SCOP 1.63
  
• d1nm1a1 appears in SCOPe 2.01
  
• d1nm1a1 appears in SCOPe 2.03
  
• d1nm1a1 appears in the current release, SCOPe 2.08