SCOP 1.63: Domain d1nljb_: 1nlj B:

Lineage for d1nljb_ (1nlj B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (9 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (19 proteins)

6. Protein (Pro)cathepsin K [54028] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (14 PDB entries)

8. Domain d1nljb_: 1nlj B: [80627]
   complexed with 2ca

Details for d1nljb_

PDB Entry: 1nlj, 2.4 Å

PDB Description: crystal structure of the cysteine protease human cathepsin k in complex with a covalent azepanone inhibitor

SCOP Domain Sequences for d1nljb_:

Sequence; same for both SEQRES and ATOM records:

>d1nljb_ d.3.1.1 (B:) (Pro)cathepsin K {Human (Homo sapiens)}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1nljb_:

• d1nljb_ is new in SCOP 1.63
  
• d1nljb_ appears in SCOP 1.65
  
• d1nljb_ appears in the current release, SCOPe 2.08