Lineage for d1nhw.1 (1nhw A:,C:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238382Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (31 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 238544Protein Enoyl-ACP reductase [51791] (4 species)
  7. 238578Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [82296] (4 PDB entries)
  8. 238583Domain d1nhw.1: 1nhw A:,C: [80518]

Details for d1nhw.1

PDB Entry: 1nhw (more details), 2.35 Å

PDB Description: Crystal Structure Analysis of Plasmodium falciparum enoyl-acyl-carrier-protein reductase

SCOP Domain Sequences for d1nhw.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1nhw.1 c.2.1.2 (A:,C:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum)}
edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkXytfidyaiey
sekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd

SCOP Domain Coordinates for d1nhw.1:

Click to download the PDB-style file with coordinates for d1nhw.1.
(The format of our PDB-style files is described here.)

Timeline for d1nhw.1: