Lineage for d1nceb_ (1nce B:)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (48 PDB entries) 
Domain d1nceb_: 1nce B: [80402]
complexed with cb3, cxm, ump; mutant
Details for d1nceb_
PDB Entry: 1nce (more details), 2.4 Å
PDB Description: crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717
SCOP Domain Sequences for d1nceb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nceb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrsccvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d1nceb_:
Click to download the PDB-style file with coordinates for d1nceb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nceb_:
- d1nceb_ is new in SCOP 1.63
- d1nceb_ appears in SCOP 1.65
- d1nceb_ appears in the current release, SCOPe 2.08
View in 3D
