| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.1: Saposin [47862] (3 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
| Family a.64.1.3: Saposin B [81806] (1 protein) the alternative subunit conformation is an open four-helical bundle; helices 3 and 4 form a contiguous helix |
| Protein Saposin B [81807] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81808] (1 PDB entry) |
| Domain d1n69b_: 1n69 B: [80119] |
PDB Entry: 1n69 (more details), 2.2 Å
SCOP Domain Sequences for d1n69b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n69b_ a.64.1.3 (B:) Saposin B {Human (Homo sapiens)}
mdgdvcqdciqmvtdiqtavrtnstfvqalvehvkeecdrlgpgmadicknyisqyseia
iqmmmhmqpkeicalvgfcd
Timeline for d1n69b_: