Lineage for d1n69b_ (1n69 B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215048Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 215049Superfamily a.64.1: Saposin [47862] (3 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 215063Family a.64.1.3: Saposin B [81806] (1 protein)
    the alternative subunit conformation is an open four-helical bundle; helices 3 and 4 form a contiguous helix
  6. 215064Protein Saposin B [81807] (1 species)
  7. 215065Species Human (Homo sapiens) [TaxId:9606] [81808] (1 PDB entry)
  8. 215067Domain d1n69b_: 1n69 B: [80119]

Details for d1n69b_

PDB Entry: 1n69 (more details), 2.2 Å

PDB Description: crystal structure of human saposin b

SCOP Domain Sequences for d1n69b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n69b_ a.64.1.3 (B:) Saposin B {Human (Homo sapiens)}
mdgdvcqdciqmvtdiqtavrtnstfvqalvehvkeecdrlgpgmadicknyisqyseia
iqmmmhmqpkeicalvgfcd

SCOP Domain Coordinates for d1n69b_:

Click to download the PDB-style file with coordinates for d1n69b_.
(The format of our PDB-style files is described here.)

Timeline for d1n69b_: