SCOPe 2.08: Domain d1n2xa2: 1n2x A:8-114,A:216-294

Lineage for d1n2xa2 (1n2x A:8-114,A:216-294)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.23: MraW-like putative methyltransferases [82475] (1 protein)

6. Protein TM0872, methyltransferase domain [82476] (2 species)
   contains an inserted alpha helical subdomain

7. Species Thermotoga maritima [TaxId:2336] [82477] (2 PDB entries)

8. Domain d1n2xa2: 1n2x A:8-114,A:216-294 [79861]
   Other proteins in same PDB: d1n2xa1, d1n2xb1
   complexed with sam, so4

Details for d1n2xa2

PDB Entry: 1n2x, 1.9 Å

PDB Description: Crystal Structure Analysis of TM0872, a Putative SAM-dependent Methyltransferase, Complexed with SAM

PDB Compounds: (A:) S-adenosyl-methyltransferase mraW

SCOPe Domain Sequences for d1n2xa2:

Sequence; same for both SEQRES and ATOM records:

>d1n2xa2 c.66.1.23 (A:8-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}
hipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevlriaeek
lkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgeXnrelenlkeflk
kaedllnpggrivvisfhsledrivketfrnskklriltekpvrpseeeirenprarsgr
lraaeri

Timeline for d1n2xa2:

• d1n2xa2 first appeared in SCOP 1.63
  
• d1n2xa2 appears in SCOPe 2.07