Lineage for d1n2xb2 (1n2x B:8-114,B:216-292)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893541Family c.66.1.23: MraW-like putative methyltransferases [82475] (1 protein)
  6. 2893542Protein TM0872, methyltransferase domain [82476] (2 species)
    contains an inserted alpha helical subdomain
  7. 2893543Species Thermotoga maritima [TaxId:2336] [82477] (2 PDB entries)
  8. 2893545Domain d1n2xb2: 1n2x B:8-114,B:216-292 [79863]
    Other proteins in same PDB: d1n2xa1, d1n2xb1
    complexed with sam, so4

Details for d1n2xb2

PDB Entry: 1n2x (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of TM0872, a Putative SAM-dependent Methyltransferase, Complexed with SAM
PDB Compounds: (B:) S-adenosyl-methyltransferase mraW

SCOPe Domain Sequences for d1n2xb2:

Sequence, based on SEQRES records: (download)

>d1n2xb2 c.66.1.23 (B:8-114,B:216-292) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}
hipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevlriaeek
lkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgeXnrelenlkeflk
kaedllnpggrivvisfhsledrivketfrnskklriltekpvrpseeeirenprarsgr
lraae

Sequence, based on observed residues (ATOM records): (download)

>d1n2xb2 c.66.1.23 (B:8-114,B:216-292) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}
hipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevlriaeek
lkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgeXnrelenlkeflk
kaedllnpggrivvisfhsledrivketfrnskklriltekpvrpsprarsgrlraae

SCOPe Domain Coordinates for d1n2xb2:

Click to download the PDB-style file with coordinates for d1n2xb2.
(The format of our PDB-style files is described here.)

Timeline for d1n2xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n2xb1