Lineage for d1n2xb1 (1n2x B:115-215)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716734Superfamily a.60.13: Putative methyltransferase TM0872, insert domain [81799] (1 family) (S)
  5. 2716735Family a.60.13.1: Putative methyltransferase TM0872, insert domain [81800] (1 protein)
  6. 2716736Protein Putative methyltransferase TM0872, insert domain [81801] (2 species)
  7. 2716737Species Thermotoga maritima [TaxId:2336] [81802] (2 PDB entries)
  8. 2716739Domain d1n2xb1: 1n2x B:115-215 [79862]
    Other proteins in same PDB: d1n2xa2, d1n2xb2
    complexed with sam, so4

Details for d1n2xb1

PDB Entry: 1n2x (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of TM0872, a Putative SAM-dependent Methyltransferase, Complexed with SAM
PDB Compounds: (B:) S-adenosyl-methyltransferase mraW

SCOPe Domain Sequences for d1n2xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2xb1 a.60.13.1 (B:115-215) Putative methyltransferase TM0872, insert domain {Thermotoga maritima [TaxId: 2336]}
nrgftfereepldmrmdlesevtaqkvlnelpeeelariifeygeekrfarriarkiven
rplnttldlvkavrealpsyeirrrkrhfatktfqairiyv

SCOPe Domain Coordinates for d1n2xb1:

Click to download the PDB-style file with coordinates for d1n2xb1.
(The format of our PDB-style files is described here.)

Timeline for d1n2xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n2xb2