SCOP 1.63: Domain d1n0jb2: 1n0j B:84-198

Lineage for d1n0jb2 (1n0j B:84-198)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (11 PDB entries)

8. Domain d1n0jb2: 1n0j B:84-198 [79743]
   Other proteins in same PDB: d1n0ja1, d1n0jb1
   complexed with mn; mutant

Details for d1n0jb2

PDB Entry: 1n0j, 2.2 Å

PDB Description: the structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles

SCOP Domain Sequences for d1n0jb2:

Sequence; same for both SEQRES and ATOM records:

>d1n0jb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1n0jb2:

• d1n0jb2 is new in SCOP 1.63
  
• d1n0jb2 appears in SCOP 1.65
  
• d1n0jb2 appears in the current release, SCOPe 2.08