SCOP 1.63: Domain d1n0jb1: 1n0j B:1-83

Lineage for d1n0jb1 (1n0j B:1-83)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (11 PDB entries)

8. Domain d1n0jb1: 1n0j B:1-83 [79742]
   Other proteins in same PDB: d1n0ja2, d1n0jb2
   complexed with mn; mutant

Details for d1n0jb1

PDB Entry: 1n0j, 2.2 Å

PDB Description: the structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles

SCOP Domain Sequences for d1n0jb1:

Sequence; same for both SEQRES and ATOM records:

>d1n0jb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1n0jb1:

• d1n0jb1 is new in SCOP 1.63
  
• d1n0jb1 appears in SCOP 1.65
  
• d1n0jb1 appears in the current release, SCOPe 2.08