![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
![]() | Protein Plasmid segregation protein ParM [82438] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [82439] (6 PDB entries) |
![]() | Domain d1mwma2: 1mwm A:158-320 [79581] complexed with adp, mg |
PDB Entry: 1mwm (more details), 2 Å
SCOPe Domain Sequences for d1mwma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwma2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} qeldeldslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm vigggaelicdavkkhtqirderffktnnsqydlvngmylign
Timeline for d1mwma2: