SCOP 1.63: Domain d1mwma2: 1mwm A:158-320

Lineage for d1mwma2 (1mwm A:158-320)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Plasmid segregation protein ParM [82438] (1 species)

7. Species Escherichia coli [TaxId:562] [82439] (2 PDB entries)

8. Domain d1mwma2: 1mwm A:158-320 [79581]

Details for d1mwma2

PDB Entry: 1mwm, 2 Å

PDB Description: parm from plasmid r1 adp form

SCOP Domain Sequences for d1mwma2:

Sequence; same for both SEQRES and ATOM records:

>d1mwma2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli}
qeldeldslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg
ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm
vigggaelicdavkkhtqirderffktnnsqydlvngmylign

Timeline for d1mwma2:

• d1mwma2 is new in SCOP 1.63
  
• d1mwma2 appears in SCOP 1.65
  
• d1mwma2 appears in the current release, SCOPe 2.08