Lineage for d1mwmb1 (1mwm B:1-157)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995078Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 995355Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 995356Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)
  8. 995363Domain d1mwmb1: 1mwm B:1-157 [79582]
    complexed with adp, mg

Details for d1mwmb1

PDB Entry: 1mwm (more details), 2 Å

PDB Description: parm from plasmid r1 adp form
PDB Compounds: (B:) ParM

SCOPe Domain Sequences for d1mwmb1:

Sequence, based on SEQRES records: (download)

>d1mwmb1 c.55.1.1 (B:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl

Sequence, based on observed residues (ATOM records): (download)

>d1mwmb1 c.55.1.1 (B:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdtniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenierkka
nfrkkitlnggdtftikdvkvmpesipagyevl

SCOPe Domain Coordinates for d1mwmb1:

Click to download the PDB-style file with coordinates for d1mwmb1.
(The format of our PDB-style files is described here.)

Timeline for d1mwmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwmb2