![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Mouse (Mus musculus), I-AB [TaxId:10090] [88828] (6 PDB entries) |
![]() | Domain d1mujb2: 1muj B:3-93 [79491] Other proteins in same PDB: d1muja1, d1muja2, d1muja3, d1mujb1, d1mujb3 complex with a human clip peptide, chain C complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1muj (more details), 2.15 Å
SCOPe Domain Sequences for d1mujb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mujb2 d.19.1.1 (B:3-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]} serhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehravtelgrpdaeywn sqpeilertraeldtvcrhnyegpethtslrr
Timeline for d1mujb2: