SCOPe 2.08: Domain d1mujb2: 1muj B:3-93

Lineage for d1mujb2 (1muj B:3-93)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Mouse (Mus musculus), I-AB [TaxId:10090] [88828] (6 PDB entries)

8. Domain d1mujb2: 1muj B:3-93 [79491]
   Other proteins in same PDB: d1muja1, d1muja2, d1muja3, d1mujb1, d1mujb3
   complex with a human clip peptide, chain C
   complexed with nag
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1mujb2

PDB Entry: 1muj, 2.15 Å

PDB Description: crystal structure of murine class ii mhc i-ab in complex with a human clip peptide

PDB Compounds: (B:) H-2 class II histocompatibility antigen, A beta chain

SCOPe Domain Sequences for d1mujb2:

Sequence; same for both SEQRES and ATOM records:

>d1mujb2 d.19.1.1 (B:3-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
serhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehravtelgrpdaeywn
sqpeilertraeldtvcrhnyegpethtslrr

Timeline for d1mujb2:

• d1mujb2 first appeared in SCOP 1.63
  
• d1mujb2 appears in SCOPe 2.07