Lineage for d1mujb1 (1muj B:94-188)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747559Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2747562Domain d1mujb1: 1muj B:94-188 [79490]
    Other proteins in same PDB: d1muja1, d1muja2, d1muja3, d1mujb2, d1mujb3
    complexed with nag

Details for d1mujb1

PDB Entry: 1muj (more details), 2.15 Å

PDB Description: crystal structure of murine class ii mhc i-ab in complex with a human clip peptide
PDB Compounds: (B:) H-2 class II histocompatibility antigen, A beta chain

SCOPe Domain Sequences for d1mujb1:

Sequence, based on SEQRES records: (download)

>d1mujb1 b.1.1.2 (B:94-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvew

Sequence, based on observed residues (ATOM records): (download)

>d1mujb1 b.1.1.2 (B:94-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislshntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm
lemtprrgevytchvehpslkspitvew

SCOPe Domain Coordinates for d1mujb1:

Click to download the PDB-style file with coordinates for d1mujb1.
(The format of our PDB-style files is described here.)

Timeline for d1mujb1: