Lineage for d1mufa1 (1muf A:81-193)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962018Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 962045Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 962046Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 962047Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 962048Species Human (Homo sapiens) [TaxId:9606] [82188] (11 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 962062Domain d1mufa1: 1muf A:81-193 [79483]
    Other proteins in same PDB: d1mufa2
    truncated from N-terminus

Details for d1mufa1

PDB Entry: 1muf (more details), 2.26 Å

PDB Description: Structure of histone H3 K4-specific methyltransferase SET7/9
PDB Compounds: (A:) set9

SCOPe Domain Sequences for d1mufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mufa1 b.76.2.1 (A:81-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vlqgtyvdgelngpaqeydtdgrlifkgqykdnirhgvcwiyypdggslvgevnedgemt
gekiayvypdertalygkfidgemiegklatlmsteegrphfelmpgnsvyhf

SCOPe Domain Coordinates for d1mufa1:

Click to download the PDB-style file with coordinates for d1mufa1.
(The format of our PDB-style files is described here.)

Timeline for d1mufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mufa2