Lineage for d1mufa2 (1muf A:194-337)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964422Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 964770Superfamily b.85.7: SET domain [82199] (3 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 964771Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
    contains metal-binding preSET and postSET domains
  6. 964777Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)
  7. 964778Species Human (Homo sapiens) [TaxId:9606] [82206] (11 PDB entries)
    Uniprot Q8WTS6 52-336
  8. 964792Domain d1mufa2: 1muf A:194-337 [79484]
    Other proteins in same PDB: d1mufa1

Details for d1mufa2

PDB Entry: 1muf (more details), 2.26 Å

PDB Description: Structure of histone H3 K4-specific methyltransferase SET7/9
PDB Compounds: (A:) set9

SCOPe Domain Sequences for d1mufa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mufa2 b.85.7.1 (A:194-337) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygy

SCOPe Domain Coordinates for d1mufa2:

Click to download the PDB-style file with coordinates for d1mufa2.
(The format of our PDB-style files is described here.)

Timeline for d1mufa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mufa1