Lineage for d1mufa1 (1muf A:81-193)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) 
11+ stranded sheet partly folded upon itself at the C-endFamily b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein) Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82188] (6 PDB entries) 
Domain d1mufa1: 1muf A:81-193 [79483]
Other proteins in same PDB: d1mufa2
truncated from N-terminus
complexed with mse
Details for d1mufa1
PDB Entry: 1muf (more details), 2.26 Å
PDB Description: Structure of histone H3 K4-specific methyltransferase SET7/9
SCOP Domain Sequences for d1mufa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mufa1 b.76.2.1 (A:81-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens)}
vlqgtyvdgelngpaqeydtdgrlifkgqykdnirhgvcwiyypdggslvgevnedgemt
gekiayvypdertalygkfidgemiegklatlmsteegrphfelmpgnsvyhf
SCOP Domain Coordinates for d1mufa1:
Click to download the PDB-style file with coordinates for d1mufa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mufa1:
- d1mufa1 is new in SCOP 1.63
- d1mufa1 appears in SCOP 1.65
- d1mufa1 appears in the current release, SCOPe 2.08
View in 3D
