| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins) |
| Protein Topoisomerase VI-B subunit [82577] (1 species) contains an H2TH domain inserted in front of this domain and after the N-terminal ATPase domain |
| Species Sulfolobus shibatae [TaxId:2286] [82578] (7 PDB entries) |
| Domain d1mu5a2: 1mu5 A:307-470 [79473] Other proteins in same PDB: d1mu5a1, d1mu5a3 complexed with ca |
PDB Entry: 1mu5 (more details), 2 Å
SCOPe Domain Sequences for d1mu5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mu5a2 d.14.1.3 (A:307-470) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}
rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge
epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag
kesiaevediekeiknalmevarklkqylsekrkeqeakkklla
Timeline for d1mu5a2: