Lineage for d1mu5a1 (1mu5 A:229-306)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507114Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1507115Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1507247Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein)
    automatically mapped to Pfam PF05833
  6. 1507248Protein Topoisomerase VI-B subunit middle domain [81706] (1 species)
  7. 1507249Species Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries)
  8. 1507254Domain d1mu5a1: 1mu5 A:229-306 [79472]
    Other proteins in same PDB: d1mu5a2, d1mu5a3
    complexed with ca

Details for d1mu5a1

PDB Entry: 1mu5 (more details), 2 Å

PDB Description: Structure of topoisomerase subunit
PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1mu5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mu5a1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Sulfolobus shibatae [TaxId: 2286]}
vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl
teeeitrlvetfkkyedf

SCOPe Domain Coordinates for d1mu5a1:

Click to download the PDB-style file with coordinates for d1mu5a1.
(The format of our PDB-style files is described here.)

Timeline for d1mu5a1: