![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
![]() | Superfamily d.95.2: Homing endonucleases [55608] (2 families) ![]() |
![]() | Family d.95.2.1: Group I mobile intron endonuclease [55609] (2 proteins) contains two extra helices in the C-terminal extension |
![]() | Protein I-dmoI [55612] (1 species) duplication: contains tandem repeat of this fold |
![]() | Species Archaeon Desulfurococcus mobilis [TaxId:2274] [55613] (2 PDB entries) |
![]() | Domain d1mowa2: 1mow A:5-99 [79361] Other proteins in same PDB: d1mowa1, d1mowd1, d1mowg1, d1mowj1 |
PDB Entry: 1mow (more details), 2.4 Å
SCOP Domain Sequences for d1mowa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mowa2 d.95.2.1 (A:5-99) I-dmoI {Archaeon Desulfurococcus mobilis} envsgisayllgliwgdgglyklkykgnrseyrvvitqksenlikqfiaprmqflideln vkskiqivkgdtryelrvsskklyyyfanmlerir
Timeline for d1mowa2: