Lineage for d1mowj2 (1mow J:1506-1599)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260550Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 260556Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 260557Family d.95.2.1: Group I mobile intron endonuclease [55609] (2 proteins)
    contains two extra helices in the C-terminal extension
  6. 260573Protein I-dmoI [55612] (1 species)
    duplication: contains tandem repeat of this fold
  7. 260574Species Archaeon Desulfurococcus mobilis [TaxId:2274] [55613] (2 PDB entries)
  8. 260580Domain d1mowj2: 1mow J:1506-1599 [79367]
    Other proteins in same PDB: d1mowa1, d1mowd1, d1mowg1, d1mowj1
    chimera of N-domain with I-CreI
    complexed with gol, mg, so4

Details for d1mowj2

PDB Entry: 1mow (more details), 2.4 Å

PDB Description: e-drei

SCOP Domain Sequences for d1mowj2:

Sequence, based on SEQRES records: (download)

>d1mowj2 d.95.2.1 (J:1506-1599) I-dmoI {Archaeon Desulfurococcus mobilis}
nvsgisayllgliwgdgglyklkykgnrseyrvvitqksenlikqfiaprmqflidelnv
kskiqivkgdtryelrvsskklyyyfanmlerir

Sequence, based on observed residues (ATOM records): (download)

>d1mowj2 d.95.2.1 (J:1506-1599) I-dmoI {Archaeon Desulfurococcus mobilis}
nvsgisayllgliwgdgglyklkynrseyrvvtqksenlikqfiaprmqflidelnvski
qivkdtryelrvsskklyyyfanmlerir

SCOP Domain Coordinates for d1mowj2:

Click to download the PDB-style file with coordinates for d1mowj2.
(The format of our PDB-style files is described here.)

Timeline for d1mowj2: