SCOP 1.65: Domain d1mlvc2: 1mlv C:50-310

Lineage for d1mlvc2 (1mlv C:50-310)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (3 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)

6. Protein RuBisCo LSMT catalytic domain [82211] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (3 PDB entries)

8. Domain d1mlvc2: 1mlv C:50-310 [79288]
   Other proteins in same PDB: d1mlva1, d1mlvb1, d1mlvc1
   complexed with epe, sah

Details for d1mlvc2

PDB Entry: 1mlv, 2.6 Å

PDB Description: structure and catalytic mechanism of a set domain protein methyltransferase

SCOP Domain Sequences for d1mlvc2:

Sequence; same for both SEQRES and ATOM records:

>d1mlvc2 b.85.7.3 (C:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum)}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh

Timeline for d1mlvc2:

• d1mlvc2 first appeared in SCOP 1.63
  
• d1mlvc2 appears in SCOP 1.67
  
• d1mlvc2 appears in the current release, SCOPe 2.08