| Class b: All beta proteins [48724] (180 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) ![]() duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core Pfam PF00856 |
| Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein) |
| Protein RuBisCo LSMT catalytic domain [82211] (1 species) |
| Species Pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries) |
| Domain d1mlvc2: 1mlv C:50-310 [79288] Other proteins in same PDB: d1mlva1, d1mlva3, d1mlvb1, d1mlvb3, d1mlvc1, d1mlvc3 complexed with epe, sah |
PDB Entry: 1mlv (more details), 2.6 Å
SCOPe Domain Sequences for d1mlvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mlvc2 b.85.7.3 (C:50-310) RuBisCo LSMT catalytic domain {Pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh
Timeline for d1mlvc2: