Class b: All beta proteins [48724] (126 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (3 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein) |
Protein RuBisCo LSMT catalytic domain [82211] (1 species) |
Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (3 PDB entries) |
Domain d1mlvb2: 1mlv B:49-310 [79286] Other proteins in same PDB: d1mlva1, d1mlvb1, d1mlvc1 |
PDB Entry: 1mlv (more details), 2.6 Å
SCOP Domain Sequences for d1mlvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mlvb2 b.85.7.3 (B:49-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum)} slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd lnksnaelaldygfiepnenrh
Timeline for d1mlvb2:
View in 3D Domains from other chains: (mouse over for more information) d1mlva1, d1mlva2, d1mlvc1, d1mlvc2 |