| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) ![]() |
| Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein) |
| Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species) |
| Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (3 PDB entries) |
| Domain d1mlvc1: 1mlv C:311-487 [79287] Other proteins in same PDB: d1mlva2, d1mlvb2, d1mlvc2 complexed with epe, sah |
PDB Entry: 1mlv (more details), 2.6 Å
SCOP Domain Sequences for d1mlvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mlvc1 a.166.1.1 (C:311-487) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum)}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenlyf
Timeline for d1mlvc1:
View in 3DDomains from other chains: (mouse over for more information) d1mlva1, d1mlva2, d1mlvb1, d1mlvb2 |