Lineage for d1ml5r_ (1ml5 R:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526374Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)
  8. 526547Domain d1ml5r_: 1ml5 R: [79273]

Details for d1ml5r_

PDB Entry: 1ml5 (more details)

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2

SCOP Domain Sequences for d1ml5r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5r_ i.1.1.1 (R:) 70S ribosome functional complex {Escherichia coli}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1ml5r_:

Click to download the PDB-style file with coordinates for d1ml5r_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5r_: